Lineage for d5tepb_ (5tep B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2220074Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2220075Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2220424Family e.8.1.2: Reverse transcriptase [56686] (3 protein domains)
  6. 2220425Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 2220467Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (172 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2284863Domain d5tepb_: 5tep B: [328164]
    Other proteins in same PDB: d5tepa2
    automated match to d2hmib_
    protein/DNA complex; complexed with 7ax

Details for d5tepb_

PDB Entry: 5tep (more details), 3.1 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 7-(2- (2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2- naphthonitrile (jlj649), a non-nucleoside inhibitor
PDB Compounds: (B:) HIV-1 reverse transcriptase, p51 subunit

SCOPe Domain Sequences for d5tepb_:

Sequence, based on SEQRES records: (download)

>d5tepb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
vlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaelela
enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
lwyq

Sequence, based on observed residues (ATOM records): (download)

>d5tepb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
stkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrky
taftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymddl
yvgsdleigqhrtkieelrqhllrwglttpyelhpdkwtvqpivlpekdswtvndiqklv
gklnwasqiypgikvrqlskllrgtkalteviplteeaelelaenreilkepvhgvyydp
skdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiv
iwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyq

SCOPe Domain Coordinates for d5tepb_:

Click to download the PDB-style file with coordinates for d5tepb_.
(The format of our PDB-style files is described here.)

Timeline for d5tepb_:

  • d5tepb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12