SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tepb_ (5tep B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2220074Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2220075Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2220424Family e.8.1.2: Reverse transcriptase [56686] (3 protein domains)
  6. 2220425Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 2220467Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (161 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2284863Domain d5tepb_: 5tep B: [328164]
    Other proteins in same PDB: d5tepa2
    automated match to d2hmib_
    protein/DNA complex; complexed with 7ax

Details for d5tepb_

PDB Entry: 5tep (more details), 3.1 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 7-(2- (2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2- naphthonitrile (jlj649), a non-nucleoside inhibitor
PDB Compounds: (B:) HIV-1 reverse transcriptase, p51 subunit

SCOPe Domain Sequences for d5tepb_:

Sequence, based on SEQRES records: (download)

>d5tepb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym
ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
vlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaelela
enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
lwyq

Sequence, based on observed residues (ATOM records): (download)

>d5tepb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
stkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrky
taftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymddl
yvgsdleigqhrtkieelrqhllrwglttpyelhpdkwtvqpivlpekdswtvndiqklv
gklnwasqiypgikvrqlskllrgtkalteviplteeaelelaenreilkepvhgvyydp
skdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiv
iwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyq

SCOPe Domain Coordinates for d5tepb_:

Click to download the PDB-style file with coordinates for d5tepb_.
(The format of our PDB-style files is described here.)

Timeline for d5tepb_:

  • d5tepb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12