SCOPe 2.06: Domain d5tg1a_: 5tg1 A:

Lineage for d5tg1a_ (5tg1 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (19 species)
   not a true protein

7. Species Norwalk virus [TaxId:524364] [313606] (11 PDB entries)

8. Domain d5tg1a_: 5tg1 A: [328160]
   automated match to d2fyqa_
   complexed with cl, v56

Details for d5tg1a_

PDB Entry: 5tg1, 1.4 Å

PDB Description: 1.40 a resolution structure of norovirus 3cl protease in complex with the a m-chlorophenyl substituted macrocyclic inhibitor (17-mer)

PDB Compounds: (A:) 3C-like protease

SCOPe Domain Sequences for d5tg1a_:

Sequence, based on SEQRES records:

>d5tg1a_ b.47.1.4 (A:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt
ganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq

Sequence, based on observed residues (ATOM records):

>d5tg1a_ b.47.1.4 (A:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmlla
nakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksntvvcavq

Timeline for d5tg1a_:

• d5tg1a_ is new in SCOPe 2.06-stable
  
• d5tg1a_ appears in SCOPe 2.07
  
• d5tg1a_ appears in the current release, SCOPe 2.08