SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tg1a_ (5tg1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2058054Protein automated matches [190384] (19 species)
    not a true protein
  7. 2270301Species Norwalk virus [TaxId:524364] [313606] (10 PDB entries)
  8. 2284859Domain d5tg1a_: 5tg1 A: [328160]
    automated match to d2fyqa_
    complexed with cl, v56

Details for d5tg1a_

PDB Entry: 5tg1 (more details), 1.4 Å

PDB Description: 1.40 a resolution structure of norovirus 3cl protease in complex with the a m-chlorophenyl substituted macrocyclic inhibitor (17-mer)
PDB Compounds: (A:) 3C-like protease

SCOPe Domain Sequences for d5tg1a_:

Sequence, based on SEQRES records: (download)

>d5tg1a_ b.47.1.4 (A:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt
ganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq

Sequence, based on observed residues (ATOM records): (download)

>d5tg1a_ b.47.1.4 (A:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmlla
nakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksntvvcavq

SCOPe Domain Coordinates for d5tg1a_:

Click to download the PDB-style file with coordinates for d5tg1a_.
(The format of our PDB-style files is described here.)

Timeline for d5tg1a_:

  • d5tg1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12