Lineage for d5tg1a_ (5tg1 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389935Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2390138Protein automated matches [190384] (19 species)
    not a true protein
  7. 2390239Species Norwalk virus [TaxId:524364] [313606] (11 PDB entries)
  8. 2390243Domain d5tg1a_: 5tg1 A: [328160]
    automated match to d2fyqa_
    complexed with cl, v56

Details for d5tg1a_

PDB Entry: 5tg1 (more details), 1.4 Å

PDB Description: 1.40 a resolution structure of norovirus 3cl protease in complex with the a m-chlorophenyl substituted macrocyclic inhibitor (17-mer)
PDB Compounds: (A:) 3C-like protease

SCOPe Domain Sequences for d5tg1a_:

Sequence, based on SEQRES records: (download)

>d5tg1a_ b.47.1.4 (A:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmllt
ganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavq

Sequence, based on observed residues (ATOM records): (download)

>d5tg1a_ b.47.1.4 (A:) automated matches {Norwalk virus [TaxId: 524364]}
tlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmlla
nakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksntvvcavq

SCOPe Domain Coordinates for d5tg1a_:

Click to download the PDB-style file with coordinates for d5tg1a_.
(The format of our PDB-style files is described here.)

Timeline for d5tg1a_: