SCOP 1.59: Domain d8gssb2: 8gss B:1-76

Lineage for d8gssb2 (8gss B:1-76)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries)

8. Domain d8gssb2: 8gss B:1-76 [32816]
   Other proteins in same PDB: d8gssa1, d8gssb1, d8gssc1

Details for d8gssb2

PDB Entry: 8gss, 1.9 Å

PDB Description: Human glutathione S-transferase P1-1, complex with glutathione

SCOP Domain Sequences for d8gssb2:

Sequence; same for both SEQRES and ATOM records:

>d8gssb2 c.47.1.5 (B:1-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d8gssb2:

• d8gssb2 first appeared (with stable ids) in SCOP 1.55
  
• d8gssb2 appears in SCOP 1.57
  
• d8gssb2 appears in SCOP 1.61
  
• d8gssb2 appears in the current release, SCOPe 2.08