SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m1ba2 (5m1b A:326-491)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216573Fold d.333: UbiD C-terminal domain-like [143967] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha-beta(2); 3 layers, a/b/a; mixed beta-sheet, order: 12354, strands 2,3 and 5 are parallel to each other
  4. 2216574Superfamily d.333.1: UbiD C-terminal domain-like [143968] (2 families) (S)
  5. 2284699Family d.333.1.0: automated matches [328000] (1 protein)
    not a true family
  6. 2284700Protein automated matches [328001] (2 species)
    not a true protein
  7. 2284705Species Escherichia coli [TaxId:199310] [328006] (3 PDB entries)
  8. 2284856Domain d5m1ba2: 5m1b A:326-491 [328157]
    Other proteins in same PDB: d5m1ba1, d5m1bb1, d5m1bc1
    automated match to d2idba2

Details for d5m1ba2

PDB Entry: 5m1b (more details), 3.15 Å

PDB Description: crystal structure of c-terminally tagged apo-ubid from e. coli
PDB Compounds: (A:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOPe Domain Sequences for d5m1ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m1ba2 d.333.1.0 (A:326-491) automated matches {Escherichia coli [TaxId: 199310]}
pdepavlgvalnevfvpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgv
wsflrqfmytkfvivcdddvnardwndviwaittrmdpardtvlventpidyldfaspvs
glgskmgldatnkwpgetqrewgrpikkdpdvvahidaiwdelaif

SCOPe Domain Coordinates for d5m1ba2:

Click to download the PDB-style file with coordinates for d5m1ba2.
(The format of our PDB-style files is described here.)

Timeline for d5m1ba2:

  • d5m1ba2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12