Lineage for d5maea_ (5mae A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155423Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2155424Protein automated matches [190230] (20 species)
    not a true protein
  7. 2155438Species Human (Homo sapiens) [TaxId:9606] [187072] (42 PDB entries)
  8. 2284854Domain d5maea_: 5mae A: [328155]
    automated match to d3of9a_
    complexed with 7kn, edo

Details for d5maea_

PDB Entry: 5mae (more details), 1 Å

PDB Description: cathepsin l in complex with (2s,4r)-4-(2-chloro-4-methoxy- benzenesulfonyl)-1-[3-(5-chloro-pyridin-2-yl)-azetidine-3-carbonyl]- pyrrolidine-2-car boxylic acid (1-cyano-cyclopropyl)-amide
PDB Compounds: (A:) Cathepsin L1

SCOPe Domain Sequences for d5maea_:

Sequence, based on SEQRES records: (download)

>d5maea_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Sequence, based on observed residues (ATOM records): (download)

>d5maea_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestnnkyw
lvknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOPe Domain Coordinates for d5maea_:

Click to download the PDB-style file with coordinates for d5maea_.
(The format of our PDB-style files is described here.)

Timeline for d5maea_:

  • d5maea_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12