SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tg6a_ (5tg6 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (37 species)
    not a true protein
  7. 2218833Species Acinetobacter baumannii [TaxId:470] [194613] (37 PDB entries)
  8. 2284853Domain d5tg6a_: 5tg6 A: [328154]
    automated match to d4f94a_
    complexed with bct, j4w, so4

Details for d5tg6a_

PDB Entry: 5tg6 (more details), 1.78 Å

PDB Description: oxa-24/40 in complex with boronic acid ba4
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5tg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tg6a_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
mhissqqhekaiksyfdaaqtqgviiikegknlstygnalarankeyvpastfkmlnali
glenhkattneifkwdgkkrtypmwekdmtlgeamalsavpvyqelarrtglelmqkevk
rvnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikev
ngskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneityksle
nlgii

SCOPe Domain Coordinates for d5tg6a_:

Click to download the PDB-style file with coordinates for d5tg6a_.
(The format of our PDB-style files is described here.)

Timeline for d5tg6a_:

  • d5tg6a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12