SCOP 1.67: Domain d8gssa2: 8gss A:1-76

Lineage for d8gssa2 (8gss A:1-76)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class pi GST [81358] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (36 PDB entries)

8. Domain d8gssa2: 8gss A:1-76 [32815]
   Other proteins in same PDB: d8gssa1, d8gssb1, d8gssc1

Details for d8gssa2

PDB Entry: 8gss, 1.9 Å

PDB Description: Human glutathione S-transferase P1-1, complex with glutathione

SCOP Domain Sequences for d8gssa2:

Sequence; same for both SEQRES and ATOM records:

>d8gssa2 c.47.1.5 (A:1-76) Class pi GST {Human (Homo sapiens)}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d8gssa2:

• d8gssa2 first appeared (with stable ids) in SCOP 1.55
  
• d8gssa2 appears in SCOP 1.65
  
• d8gssa2 appears in SCOP 1.69
  
• d8gssa2 appears in the current release, SCOPe 2.08