Lineage for d5t2ea_ (5t2e A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2058816Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2060049Protein automated matches [190433] (11 species)
    not a true protein
  7. 2060093Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (25 PDB entries)
  8. 2284846Domain d5t2ea_: 5t2e A: [328147]
    automated match to d4njsa_
    complexed with cl

Details for d5t2ea_

PDB Entry: 5t2e (more details), 1.5 Å

PDB Description: crystal structure of multi-drug resistant hiv-1 protease pr-s17
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d5t2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t2ea_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpivtikiggqlrealldtgaddtvledidlpgrwkpklivgiggfvkvrqye
qvpieiaghkvvgtvligptpsniigrnlmtqlgatlnf

SCOPe Domain Coordinates for d5t2ea_:

Click to download the PDB-style file with coordinates for d5t2ea_.
(The format of our PDB-style files is described here.)

Timeline for d5t2ea_:

  • d5t2ea_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12