Lineage for d5t2ea_ (5t2e A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2800628Protein automated matches [190433] (12 species)
    not a true protein
  7. 2800672Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (32 PDB entries)
  8. 2800689Domain d5t2ea_: 5t2e A: [328147]
    automated match to d4njsa_
    complexed with cl

Details for d5t2ea_

PDB Entry: 5t2e (more details), 1.5 Å

PDB Description: crystal structure of multi-drug resistant hiv-1 protease pr-s17
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d5t2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t2ea_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpivtikiggqlrealldtgaddtvledidlpgrwkpklivgiggfvkvrqye
qvpieiaghkvvgtvligptpsniigrnlmtqlgatlnf

SCOPe Domain Coordinates for d5t2ea_:

Click to download the PDB-style file with coordinates for d5t2ea_.
(The format of our PDB-style files is described here.)

Timeline for d5t2ea_: