SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2nafa_ (2naf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126575Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2126589Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2126590Protein automated matches [193326] (9 species)
    not a true protein
  7. 2126605Species Mycobacterium smegmatis [TaxId:246196] [225939] (5 PDB entries)
  8. 2284842Domain d2nafa_: 2naf A: [328143]
    automated match to d2lgja_

Details for d2nafa_

PDB Entry: 2naf (more details)

PDB Description: solution structure of peptidyl-trna hydrolase from mycobacterium smegmatis
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d2nafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nafa_ c.56.3.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
maepllvvglgnpgptyaktrhnlgfmvadvlagrigsafkvhkksgaevvtgrlagtsv
vlakprcymnesgrqvgplakfysvppqqivvihdeldidfgrirlklgggegghnglrs
vasalgtknfhrvrigvgrppgrkdpaafvlenftaaeraevptiveqaadatelliaqg
lepaqntvhaw

SCOPe Domain Coordinates for d2nafa_:

Click to download the PDB-style file with coordinates for d2nafa_.
(The format of our PDB-style files is described here.)

Timeline for d2nafa_:

  • d2nafa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12