SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kwed1 (5kwe D:3-254)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2094309Species Agrobacterium tumefaciens [TaxId:358] [193697] (5 PDB entries)
  8. 2284840Domain d5kwed1: 5kwe D:3-254 [328141]
    Other proteins in same PDB: d5kwea2, d5kweb2, d5kwec2, d5kwed2
    automated match to d3zn2a_
    complexed with cl, na; mutant

Details for d5kwed1

PDB Entry: 5kwe (more details), 1.68 Å

PDB Description: thermostable mutant of halohydrin dehalogenase hhec - c153n
PDB Compounds: (D:) halohydrin dehalogenase

SCOPe Domain Sequences for d5kwed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kwed1 c.2.1.0 (D:3-254) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
taivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepael
ieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkkr
ksghiifitsatpfgpwkelstytsaragantlanalskelgeynipvfaigpnylhsed
spyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlagg
fpmierwpgmpe

SCOPe Domain Coordinates for d5kwed1:

Click to download the PDB-style file with coordinates for d5kwed1.
(The format of our PDB-style files is described here.)

Timeline for d5kwed1:

  • d5kwed1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12