Lineage for d5mrlb2 (5mrl B:290-401)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161032Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2161033Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2161246Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 protein domains)
  6. 2161299Protein Monoamine oxidase B [69673] (2 species)
  7. 2161300Species Human (Homo sapiens) [TaxId:9606] [69674] (39 PDB entries)
  8. 2284839Domain d5mrlb2: 5mrl B:290-401 [328140]
    Other proteins in same PDB: d5mrla1, d5mrlb1
    automated match to d1s3ea2
    complexed with f2m, fad

Details for d5mrlb2

PDB Entry: 5mrl (more details), 2.42 Å

PDB Description: crystal structure of human monoamine oxidase b (mao b) in complex with n(furan2ylmethyl)nmethylprop2yn1amine (f2mpa)
PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d5mrlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mrlb2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOPe Domain Coordinates for d5mrlb2:

Click to download the PDB-style file with coordinates for d5mrlb2.
(The format of our PDB-style files is described here.)

Timeline for d5mrlb2:

  • d5mrlb2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5mrlb1