SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m0oa_ (5m0o A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (59 species)
    not a true protein
  7. 2005692Species Jeotgalicoccus sp. [TaxId:946435] [229305] (5 PDB entries)
  8. 2284835Domain d5m0oa_: 5m0o A: [328136]
    Other proteins in same PDB: d5m0oc2
    automated match to d4l54a_
    complexed with epa, hem, so4

Details for d5m0oa_

PDB Entry: 5m0o (more details), 1.8 Å

PDB Description: crystal structure of cytochrome p450 olet h85q in complex with arachidonic acid
PDB Compounds: (A:) Terminal olefin-forming fatty acid decarboxylase

SCOPe Domain Sequences for d5m0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m0oa_ a.104.1.0 (A:) automated matches {Jeotgalicoccus sp. [TaxId: 946435]}
lkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkegaemfynndv
vqregmlpkrivntlfgkgaiqtvdgkkhvdrkalfmslmtegnlnyvreltrtlwhant
qrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfralggafkgy
kaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsrtcaidlmnt
frpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpflpgkakvdi
dfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipqgggdywtnh
rcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfviknvrevvdrt

SCOPe Domain Coordinates for d5m0oa_:

Click to download the PDB-style file with coordinates for d5m0oa_.
(The format of our PDB-style files is described here.)

Timeline for d5m0oa_:

  • d5m0oa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12