SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m09a_ (5m09 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2284711Species Mycobacterium tuberculosis [TaxId:83332] [328012] (4 PDB entries)
  8. 2284834Domain d5m09a_: 5m09 A: [328135]
    automated match to d1o6ya_
    complexed with na; mutant

Details for d5m09a_

PDB Entry: 5m09 (more details), 2.98 Å

PDB Description: crystal structure of mycobacterium tuberculosis pkni kinase domain, c20a_r136n double mutant
PDB Compounds: (A:) Serine/threonine-protein kinase PknI

SCOPe Domain Sequences for d5m09a_:

Sequence, based on SEQRES records: (download)

>d5m09a_ d.144.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
malasgvtfagytvvrmlgasamgevylvqhpgfpgwqalkvlspamaaddefrrrfqre
tevaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivta
vagaldyahqrgllhndvnpanvvltsqsagdqrilladfgiasqpsypapelsagadvd
gradqyalaltaihlfagappvdrshtgplqppklsafrpdlarldgvlsralatapadr
fgscrefadamneqag

Sequence, based on observed residues (ATOM records): (download)

>d5m09a_ d.144.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
malasgvtfagytvvrmlgasamgevylvqhpgfpgwqalkvlspamaaddefrrrfqre
tevaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivta
vagaldyahqrgllhndvnpanvvltsqdqrilladfgiasqpsypapelsagadvdgra
dqyalaltaihlfagappvdqppklsafrpdlarldgvlsralatapadrfgscrefada
mneqag

SCOPe Domain Coordinates for d5m09a_:

Click to download the PDB-style file with coordinates for d5m09a_.
(The format of our PDB-style files is described here.)

Timeline for d5m09a_:

  • d5m09a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12