Lineage for d5kwea1 (5kwe A:3-254)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (233 species)
    not a true protein
  7. 2094309Species Agrobacterium tumefaciens [TaxId:358] [193697] (5 PDB entries)
  8. 2284832Domain d5kwea1: 5kwe A:3-254 [328133]
    Other proteins in same PDB: d5kwea2, d5kweb2, d5kwec2, d5kwed2
    automated match to d3zn2a_
    complexed with cl, na; mutant

Details for d5kwea1

PDB Entry: 5kwe (more details), 1.68 Å

PDB Description: thermostable mutant of halohydrin dehalogenase hhec - c153n
PDB Compounds: (A:) halohydrin dehalogenase

SCOPe Domain Sequences for d5kwea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kwea1 c.2.1.0 (A:3-254) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
taivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepael
ieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkkr
ksghiifitsatpfgpwkelstytsaragantlanalskelgeynipvfaigpnylhsed
spyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlagg
fpmierwpgmpe

SCOPe Domain Coordinates for d5kwea1:

Click to download the PDB-style file with coordinates for d5kwea1.
(The format of our PDB-style files is described here.)

Timeline for d5kwea1:

  • d5kwea1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12