Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) |
Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
Protein automated matches [227065] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [273041] (10 PDB entries) |
Domain d5lqfc_: 5lqf C: [328125] Other proteins in same PDB: d5lqfa1, d5lqfa2, d5lqfd1, d5lqfd2 automated match to d1cksb_ complexed with 4sp |
PDB Entry: 5lqf (more details), 2.06 Å
SCOPe Domain Sequences for d5lqfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lqfc_ d.97.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymih epephillfrrplp
Timeline for d5lqfc_: