Lineage for d5lqfc_ (5lqf C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186443Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2186444Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2186445Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 protein domains)
  6. 2186472Protein automated matches [227065] (3 species)
    not a true protein
  7. 2186481Species Human (Homo sapiens) [TaxId:9606] [273041] (5 PDB entries)
  8. 2284824Domain d5lqfc_: 5lqf C: [328125]
    Other proteins in same PDB: d5lqfa1, d5lqfa2, d5lqfd1, d5lqfd2
    automated match to d1cksb_
    complexed with 4sp

Details for d5lqfc_

PDB Entry: 5lqf (more details), 2.06 Å

PDB Description: cdk1/cyclinb1/cks2 in complex with nu6102
PDB Compounds: (C:) Cyclin-dependent kinases regulatory subunit 2

SCOPe Domain Sequences for d5lqfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqfc_ d.97.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymih
epephillfrrplp

SCOPe Domain Coordinates for d5lqfc_:

Click to download the PDB-style file with coordinates for d5lqfc_.
(The format of our PDB-style files is described here.)

Timeline for d5lqfc_:

  • d5lqfc_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12