SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mr1a_ (5mr1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062158Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2062159Protein automated matches [190052] (6 species)
    not a true protein
  7. 2062184Species Human (Homo sapiens) [TaxId:9606] [186914] (52 PDB entries)
  8. 2284823Domain d5mr1a_: 5mr1 A: [328124]
    automated match to d1u5dd_

Details for d5mr1a_

PDB Entry: 5mr1 (more details), 1.2 Å

PDB Description: crystal structure of the pleckstrin homology domain of interactor protein for cytohesin exchange factors 1 (ipcef1)
PDB Compounds: (A:) Interactor protein for cytohesin exchange factors 1

SCOPe Domain Sequences for d5mr1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mr1a_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adcqgwlykkkekgsflsnkwkkfwvilkgsslywysnqmaekadgfvnlpdftverase
ckkkhafkishpqiktfyfaaenvqemnvwlnklgsavihq

SCOPe Domain Coordinates for d5mr1a_:

Click to download the PDB-style file with coordinates for d5mr1a_.
(The format of our PDB-style files is described here.)

Timeline for d5mr1a_:

  • d5mr1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12