![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
![]() | Protein automated matches [190052] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186914] (58 PDB entries) |
![]() | Domain d5mr1a_: 5mr1 A: [328124] automated match to d1u5dd_ |
PDB Entry: 5mr1 (more details), 1.2 Å
SCOPe Domain Sequences for d5mr1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mr1a_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} adcqgwlykkkekgsflsnkwkkfwvilkgsslywysnqmaekadgfvnlpdftverase ckkkhafkishpqiktfyfaaenvqemnvwlnklgsavihq
Timeline for d5mr1a_: