Lineage for d5mr1a_ (5mr1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062158Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2062159Protein automated matches [190052] (6 species)
    not a true protein
  7. 2062184Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)
  8. 2284823Domain d5mr1a_: 5mr1 A: [328124]
    automated match to d1u5dd_

Details for d5mr1a_

PDB Entry: 5mr1 (more details), 1.2 Å

PDB Description: crystal structure of the pleckstrin homology domain of interactor protein for cytohesin exchange factors 1 (ipcef1)
PDB Compounds: (A:) Interactor protein for cytohesin exchange factors 1

SCOPe Domain Sequences for d5mr1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mr1a_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adcqgwlykkkekgsflsnkwkkfwvilkgsslywysnqmaekadgfvnlpdftverase
ckkkhafkishpqiktfyfaaenvqemnvwlnklgsavihq

SCOPe Domain Coordinates for d5mr1a_:

Click to download the PDB-style file with coordinates for d5mr1a_.
(The format of our PDB-style files is described here.)

Timeline for d5mr1a_:

  • d5mr1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12