SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mcla_ (5mcl A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (51 species)
    not a true protein
  7. 2268332Species Daphnia pulex [TaxId:6669] [311638] (12 PDB entries)
  8. 2284822Domain d5mcla_: 5mcl A: [328123]
    automated match to d4xnnb_
    complexed with gol, so4

Details for d5mcla_

PDB Entry: 5mcl (more details), 2 Å

PDB Description: radiation damage to gh7 family cellobiohydrolase from daphnia pulex: dose (dwd) 18.4 mgy
PDB Compounds: (A:) Cellobiohydrolase CHBI

SCOPe Domain Sequences for d5mcla_:

Sequence, based on SEQRES records: (download)

>d5mcla_ b.29.1.0 (A:) automated matches {Daphnia pulex [TaxId: 6669]}
envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl
cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvgpystnigartflldstkt
ryrmfqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaq
cphdvkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndq
trcegvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfi
ttdgtdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhkn
kggmkqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvps
evevtqanavvsfgnikfgpigstv

Sequence, based on observed residues (ATOM records): (download)

>d5mcla_ b.29.1.0 (A:) automated matches {Daphnia pulex [TaxId: 6669]}
envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl
cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvstnigartflldstktryr
mfqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaqcph
dvkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndqtrc
egvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfittd
gtdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhknkgg
mkqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvpseve
vtqanavvsfgnikfgpigstv

SCOPe Domain Coordinates for d5mcla_:

Click to download the PDB-style file with coordinates for d5mcla_.
(The format of our PDB-style files is described here.)

Timeline for d5mcla_:

  • d5mcla_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12