SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m0na1 (5m0n A:1-422)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (59 species)
    not a true protein
  7. 2005692Species Jeotgalicoccus sp. [TaxId:946435] [229305] (5 PDB entries)
  8. 2284820Domain d5m0na1: 5m0n A:1-422 [328121]
    Other proteins in same PDB: d5m0na2
    automated match to d4l54a_
    complexed with fmt, hem, so4

Details for d5m0na1

PDB Entry: 5m0n (more details), 1.44 Å

PDB Description: crystal structure of cytochrome p450 olet in complex with formate
PDB Compounds: (A:) Terminal olefin-forming fatty acid decarboxylase

SCOPe Domain Sequences for d5m0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m0na1 a.104.1.0 (A:1-422) automated matches {Jeotgalicoccus sp. [TaxId: 946435]}
matlkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkegaemfyn
ndvvqregmlpkrivntlfgkgaihtvdgkkhvdrkalfmslmtegnlnyvreltrtlwh
antqrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfralggaf
kgykaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsrtcaidl
mntfrpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpflpgkak
vdidfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipqgggdyw
tnhrcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfviknvrevvd
rt

SCOPe Domain Coordinates for d5m0na1:

Click to download the PDB-style file with coordinates for d5m0na1.
(The format of our PDB-style files is described here.)

Timeline for d5m0na1:

  • d5m0na1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5m0na2