Lineage for d5m0na1 (5m0n A:1-422)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (61 species)
    not a true protein
  7. 2005692Species Jeotgalicoccus sp. [TaxId:946435] [229305] (5 PDB entries)
  8. 2284820Domain d5m0na1: 5m0n A:1-422 [328121]
    Other proteins in same PDB: d5m0na2
    automated match to d4l54a_
    complexed with fmt, hem, so4

Details for d5m0na1

PDB Entry: 5m0n (more details), 1.44 Å

PDB Description: crystal structure of cytochrome p450 olet in complex with formate
PDB Compounds: (A:) Terminal olefin-forming fatty acid decarboxylase

SCOPe Domain Sequences for d5m0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m0na1 a.104.1.0 (A:1-422) automated matches {Jeotgalicoccus sp. [TaxId: 946435]}
matlkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkegaemfyn
ndvvqregmlpkrivntlfgkgaihtvdgkkhvdrkalfmslmtegnlnyvreltrtlwh
antqrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfralggaf
kgykaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsrtcaidl
mntfrpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpflpgkak
vdidfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipqgggdyw
tnhrcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfviknvrevvd
rt

SCOPe Domain Coordinates for d5m0na1:

Click to download the PDB-style file with coordinates for d5m0na1.
(The format of our PDB-style files is described here.)

Timeline for d5m0na1:

  • d5m0na1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5m0na2