SCOP 1.55: Domain d1aqwb2: 1aqw B:1-76

Lineage for d1aqwb2 (1aqw B:1-76)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries)

8. Domain d1aqwb2: 1aqw B:1-76 [32812]
   Other proteins in same PDB: d1aqwa1, d1aqwb1, d1aqwc1, d1aqwd1

Details for d1aqwb2

PDB Entry: 1aqw, 1.8 Å

PDB Description: glutathione s-transferase in complex with glutathione

SCOP Domain Sequences for d1aqwb2:

Sequence; same for both SEQRES and ATOM records:

>d1aqwb2 c.47.1.5 (B:1-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d1aqwb2:

• d1aqwb2 appears in SCOP 1.57
  
• d1aqwb2 appears in the current release, SCOPe 2.08