Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) |
Protein Glutathione S-transferase [52863] (22 species) |
Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries) |
Domain d1aqwb2: 1aqw B:1-76 [32812] Other proteins in same PDB: d1aqwa1, d1aqwb1, d1aqwc1, d1aqwd1 |
PDB Entry: 1aqw (more details), 1.8 Å
SCOP Domain Sequences for d1aqwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqwb2 c.47.1.5 (B:1-76) Glutathione S-transferase {Human (Homo sapiens), class pi} ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl tlyqsntilrhlgrtl
Timeline for d1aqwb2: