SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2nana_ (2nan A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2209498Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2209499Protein automated matches [190159] (15 species)
    not a true protein
  7. 2209545Species Human (Homo sapiens) [TaxId:9606] [186882] (77 PDB entries)
  8. 2284818Domain d2nana_: 2nan A: [328119]
    automated match to d3wbre_

Details for d2nana_

PDB Entry: 2nan (more details)

PDB Description: nmr structure of human dcl-1 (cd302) extracellular domain
PDB Compounds: (A:) CD302 antigen

SCOPe Domain Sequences for d2nana_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nana_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdcpsstwiqfqdscyiflqeaikvesiedvrnqctdhgadmisihneeenafildtlkk
qwkgpddillgmfydtddasfkwfdnsnmtfdkwtdqdddedlvdtcaflhiktgewkkg
ncevssvegtlcktaipykr

SCOPe Domain Coordinates for d2nana_:

Click to download the PDB-style file with coordinates for d2nana_.
(The format of our PDB-style files is described here.)

Timeline for d2nana_:

  • d2nana_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12