Lineage for d5m06b_ (5m06 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2284711Species Mycobacterium tuberculosis [TaxId:83332] [328012] (4 PDB entries)
  8. 2284814Domain d5m06b_: 5m06 B: [328115]
    automated match to d2fuma_
    complexed with adp, ca

Details for d5m06b_

PDB Entry: 5m06 (more details), 2 Å

PDB Description: crystal structure of mycobacterium tuberculosis pkni kinase domain
PDB Compounds: (B:) Serine/threonine-protein kinase PknI

SCOPe Domain Sequences for d5m06b_:

Sequence, based on SEQRES records: (download)

>d5m06b_ d.144.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
alasgvtfagytvvrmlgcsamgevylvqhpgfpgwqalkvlspamaaddefrrrfqret
evaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivtav
agaldyahqrgllhrdvnpanvvltsqsagdqrilladfgiasqpsypapelsagadvdg
radqyalaltaihlfagappvdrshtgplqppklsafrpdlarldgvlsralatapadrf
gscrefadamneqa

Sequence, based on observed residues (ATOM records): (download)

>d5m06b_ d.144.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
alasgvtfagytvvrmlgcsamgevylvqhpgfpgwqalkvlspamaaddefrrrfqret
evaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivtav
agaldyahqrgllhrdvnpanvvltsgdqrilladfgiasqpsypapelsagadvdgrad
qyalaltaihlfagappvdrsplqppklsafrpdlarldgvlsralatapadrfgscref
adamneqa

SCOPe Domain Coordinates for d5m06b_:

Click to download the PDB-style file with coordinates for d5m06b_.
(The format of our PDB-style files is described here.)

Timeline for d5m06b_:

  • d5m06b_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12