SCOPe 2.08: Domain d5hdna1: 5hdn A:15-118

Lineage for d5hdna1 (5hdn A:15-118)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
   automatically mapped to Pfam PF00447

6. Protein automated matches [254598] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255429] (7 PDB entries)

8. Domain d5hdna1: 5hdn A:15-118 [328112]
   Other proteins in same PDB: d5hdna2, d5hdnb2, d5hdnc2, d5hdnd2
   automated match to d1hksa_
   protein/DNA complex; complexed with cit, na

Details for d5hdna1

PDB Entry: 5hdn, 1.68 Å

PDB Description: crystal structure of heat shock factor1-dbd complex with ds-dna and ttt

PDB Compounds: (A:) Heat shock factor protein 1

SCOPe Domain Sequences for d5hdna1:

Sequence, based on SEQRES records:

>d5hdna1 a.4.5.22 (A:15-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrk

Sequence, based on observed residues (ATOM records):

>d5hdna1 a.4.5.22 (A:15-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhievkperddtefqhpcflrgqeqllenikrk

Timeline for d5hdna1:

• d5hdna1 first appeared in SCOPe 2.06
  
• d5hdna1 appears in SCOPe 2.07