SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mrla2 (5mrl A:290-401)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161032Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2161033Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2161246Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 protein domains)
  6. 2161299Protein Monoamine oxidase B [69673] (2 species)
  7. 2161300Species Human (Homo sapiens) [TaxId:9606] [69674] (39 PDB entries)
  8. 2284799Domain d5mrla2: 5mrl A:290-401 [328100]
    Other proteins in same PDB: d5mrla1, d5mrlb1
    automated match to d1s3ea2
    complexed with f2m, fad

Details for d5mrla2

PDB Entry: 5mrl (more details), 2.42 Å

PDB Description: crystal structure of human monoamine oxidase b (mao b) in complex with n(furan2ylmethyl)nmethylprop2yn1amine (f2mpa)
PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d5mrla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mrla2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOPe Domain Coordinates for d5mrla2:

Click to download the PDB-style file with coordinates for d5mrla2.
(The format of our PDB-style files is described here.)

Timeline for d5mrla2:

  • d5mrla2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5mrla1