SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mrla1 (5mrl A:3-289,A:402-501)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096622Protein Monoamine oxidase B [69423] (2 species)
  7. 2096623Species Human (Homo sapiens) [TaxId:9606] [69424] (39 PDB entries)
  8. 2284798Domain d5mrla1: 5mrl A:3-289,A:402-501 [328099]
    Other proteins in same PDB: d5mrla2, d5mrlb2
    automated match to d1s3ea1
    complexed with f2m, fad

Details for d5mrla1

PDB Entry: 5mrl (more details), 2.42 Å

PDB Description: crystal structure of human monoamine oxidase b (mao b) in complex with n(furan2ylmethyl)nmethylprop2yn1amine (f2mpa)
PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d5mrla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mrla1 c.3.1.2 (A:3-289,A:402-501) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrv
lrqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvp
aqpitttflerhlpsvpgllrligltti

SCOPe Domain Coordinates for d5mrla1:

Click to download the PDB-style file with coordinates for d5mrla1.
(The format of our PDB-style files is described here.)

Timeline for d5mrla1:

  • d5mrla1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5mrla2