Lineage for d5mrla1 (5mrl A:3-289,A:402-501)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096622Protein Monoamine oxidase B [69423] (2 species)
  7. 2096623Species Human (Homo sapiens) [TaxId:9606] [69424] (39 PDB entries)
  8. 2284798Domain d5mrla1: 5mrl A:3-289,A:402-501 [328099]
    Other proteins in same PDB: d5mrla2, d5mrlb2
    automated match to d1s3ea1
    complexed with f2m, fad

Details for d5mrla1

PDB Entry: 5mrl (more details), 2.42 Å

PDB Description: crystal structure of human monoamine oxidase b (mao b) in complex with n(furan2ylmethyl)nmethylprop2yn1amine (f2mpa)
PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d5mrla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mrla1 c.3.1.2 (A:3-289,A:402-501) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrv
lrqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvp
aqpitttflerhlpsvpgllrligltti

SCOPe Domain Coordinates for d5mrla1:

Click to download the PDB-style file with coordinates for d5mrla1.
(The format of our PDB-style files is described here.)

Timeline for d5mrla1:

  • d5mrla1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5mrla2