Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries) |
Domain d5lqfa1: 5lqf A:1-289 [328096] Other proteins in same PDB: d5lqfa2, d5lqfc_, d5lqfd2, d5lqff_ automated match to d4ek4a_ complexed with 4sp |
PDB Entry: 5lqf (more details), 2.06 Å
SCOPe Domain Sequences for d5lqfa1:
Sequence, based on SEQRES records: (download)
>d5lqfa1 d.144.1.7 (A:1-289) automated matches {Human (Homo sapiens) [TaxId: 9606]} medytkiekigegtygvvykgrhkttgqvvamkkirleseeegvpstaireisllkelrh pnivslqdvlmqdsrlylifeflsmdlkkyldsippgqymdsslvksylyqilqgivfch srrvlhrdlkpqnlliddkgtikladfglarafgipirvythevvtlwyrspevllgsar ystpvdiwsigtifaelatkkplfhgdseidqlfrifralgtpnnevwpeveslqdyknt fpkwkpgslashvknldengldllskmliydpakrisgkmalnhpyfnd
>d5lqfa1 d.144.1.7 (A:1-289) automated matches {Human (Homo sapiens) [TaxId: 9606]} medytkiekigegtygvvykgrhkttgqvvamkkirleseeegvpstaireisllkelrh pnivslqdvlmqdsrlylifeflsmdlkkyldsippgqymdsslvksylyqilqgivfch srrvlhrdlkpqnlliddkgtikladfglarafgipirvvtlwyrspevllgsarystpv diwsigtifaelatkkplfhgdseidqlfrifralgtpnnevwpeveslqdykntfpkwk pgslashvknldengldllskmliydpakrisgkmalnhpyfnd
Timeline for d5lqfa1:
View in 3D Domains from other chains: (mouse over for more information) d5lqfc_, d5lqfd1, d5lqfd2, d5lqff_ |