Lineage for d5m07a_ (5m07 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (27 species)
    not a true protein
  7. 2547775Species Mycobacterium tuberculosis [TaxId:83332] [328012] (5 PDB entries)
  8. 2547778Domain d5m07a_: 5m07 A: [328095]
    automated match to d1o6ya_
    complexed with na; mutant

Details for d5m07a_

PDB Entry: 5m07 (more details), 2.5 Å

PDB Description: crystal structure of mycobacterium tuberculosis pkni kinase domain, c20a mutant
PDB Compounds: (A:) Serine/threonine-protein kinase PknI

SCOPe Domain Sequences for d5m07a_:

Sequence, based on SEQRES records: (download)

>d5m07a_ d.144.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
malasgvtfagytvvrmlgasamgevylvqhpgfpgwqalkvlspamaaddefrrrfqre
tevaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivta
vagaldyahqrgllhrdvnpanvvltsqsagdqrilladfgiasqpsypapelsagadvd
gradqyalaltaihlfagappvdrshtgplqppklsafrpdlarldgvlsralatapadr
fgscrefadamneqag

Sequence, based on observed residues (ATOM records): (download)

>d5m07a_ d.144.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
malasgvtfagytvvrmlgasamgevylvqhpgfpgwqalkvlspamaaddefrrrfqre
tevaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivta
vagaldyahqrgllhrdvnpanvvltsqdqrilladfgiasqpsypapelsagadvdgra
dqyalaltaihlfagappvdrlqppklsafrpdlarldgvlsralatapadrfgscrefa
damneqag

SCOPe Domain Coordinates for d5m07a_:

Click to download the PDB-style file with coordinates for d5m07a_.
(The format of our PDB-style files is described here.)

Timeline for d5m07a_: