SCOPe 2.06: Domain d5m1ea2: 5m1e A:326-492

Lineage for d5m1ea2 (5m1e A:326-492)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.333: UbiD C-terminal domain-like [143967] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha-beta(2); 3 layers, a/b/a; mixed beta-sheet, order: 12354, strands 2,3 and 5 are parallel to each other

4. Superfamily d.333.1: UbiD C-terminal domain-like [143968] (2 families)

5. Family d.333.1.0: automated matches [328000] (1 protein)
   not a true family

6. Protein automated matches [328001] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:199310] [328006] (3 PDB entries)

8. Domain d5m1ea2: 5m1e A:326-492 [328091]
   Other proteins in same PDB: d5m1ea1, d5m1eb1, d5m1ec1
   automated match to d2idba2
   complexed with 7d9, mn, na

Details for d5m1ea2

PDB Entry: 5m1e, 2.62 Å

PDB Description: crystal structure of n-terminally tagged ubid from e. coli reconstituted with prfmn cofactor

PDB Compounds: (A:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOPe Domain Sequences for d5m1ea2:

Sequence; same for both SEQRES and ATOM records:

>d5m1ea2 d.333.1.0 (A:326-492) automated matches {Escherichia coli [TaxId: 199310]}
pdepavlgvalnevfvpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgv
wsflrqfmytkfvivcdddvnardwndviwaittrmdpardtvlventpidyldfaspvs
glgskmgldatnkwpgetqrewgrpikkdpdvvahidaiwdelaifn

Timeline for d5m1ea2:

• d5m1ea2 is new in SCOPe 2.06-stable
  
• d5m1ea2 appears in SCOPe 2.07
  
• d5m1ea2 appears in the current release, SCOPe 2.08