Lineage for d5m1ea1 (5m1e A:6-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055414Family b.45.1.3: UbiD middle domain-like [141368] (2 protein domains)
    N terminal part of Pfam PF01977; overall structural similarity to one subunit of the NADH:FMN oxidoreductase-like family (50482); not known to bind a flavin cofactor; also includes the N-terminal alpha+beta subdomain (~110 residues)
  6. 2284696Protein automated matches [327997] (2 species)
    not a true protein
  7. 2284703Species Escherichia coli [TaxId:199310] [328004] (3 PDB entries)
  8. 2284789Domain d5m1ea1: 5m1e A:6-325 [328090]
    Other proteins in same PDB: d5m1ea2, d5m1eb2, d5m1ec2
    automated match to d2idba1
    complexed with 7d9, mn, na

Details for d5m1ea1

PDB Entry: 5m1e (more details), 2.62 Å

PDB Description: crystal structure of n-terminally tagged ubid from e. coli reconstituted with prfmn cofactor
PDB Compounds: (A:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOPe Domain Sequences for d5m1ea1:

Sequence, based on SEQRES records: (download)

>d5m1ea1 b.45.1.3 (A:6-325) automated matches {Escherichia coli [TaxId: 199310]}
yndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcn
lfgtpkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnmptkrl
rgapcqqkivsgddvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyrqqlig
knklimrwlshrggaldyqewcaahpgerfpvsvalgadpatilgavtpvpdtlseyafa
gllrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgyynevdsfpvft
vthitqredaiyhstytgrp

Sequence, based on observed residues (ATOM records): (download)

>d5m1ea1 b.45.1.3 (A:6-325) automated matches {Escherichia coli [TaxId: 199310]}
yndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcn
lfgtpkrvamgmgqedvsalrevgkllaflkkqvlnmptkrlrgapcqqkivsgddvdln
ripimtcwpedaaplitwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldy
qewcaahpgerfpvsvalgadpatilgavtpvpdtlseyafagllrgtktevvkcisndl
evpasaeivlegyieqgetapegpygdhtgyynevdsfpvftvthitqredaiyhstytg
rp

SCOPe Domain Coordinates for d5m1ea1:

Click to download the PDB-style file with coordinates for d5m1ea1.
(The format of our PDB-style files is described here.)

Timeline for d5m1ea1:

  • d5m1ea1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12