SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m1ea1 (5m1e A:6-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055414Family b.45.1.3: UbiD middle domain-like [141368] (2 protein domains)
    N terminal part of Pfam PF01977; overall structural similarity to one subunit of the NADH:FMN oxidoreductase-like family (50482); not known to bind a flavin cofactor; also includes the N-terminal alpha+beta subdomain (~110 residues)
  6. 2284696Protein automated matches [327997] (2 species)
    not a true protein
  7. 2284703Species Escherichia coli [TaxId:199310] [328004] (3 PDB entries)
  8. 2284789Domain d5m1ea1: 5m1e A:6-325 [328090]
    Other proteins in same PDB: d5m1ea2, d5m1eb2, d5m1ec2
    automated match to d2idba1
    complexed with 7d9, mn, na

Details for d5m1ea1

PDB Entry: 5m1e (more details), 2.62 Å

PDB Description: crystal structure of n-terminally tagged ubid from e. coli reconstituted with prfmn cofactor
PDB Compounds: (A:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOPe Domain Sequences for d5m1ea1:

Sequence, based on SEQRES records: (download)

>d5m1ea1 b.45.1.3 (A:6-325) automated matches {Escherichia coli [TaxId: 199310]}
yndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcn
lfgtpkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnmptkrl
rgapcqqkivsgddvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyrqqlig
knklimrwlshrggaldyqewcaahpgerfpvsvalgadpatilgavtpvpdtlseyafa
gllrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgyynevdsfpvft
vthitqredaiyhstytgrp

Sequence, based on observed residues (ATOM records): (download)

>d5m1ea1 b.45.1.3 (A:6-325) automated matches {Escherichia coli [TaxId: 199310]}
yndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcn
lfgtpkrvamgmgqedvsalrevgkllaflkkqvlnmptkrlrgapcqqkivsgddvdln
ripimtcwpedaaplitwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldy
qewcaahpgerfpvsvalgadpatilgavtpvpdtlseyafagllrgtktevvkcisndl
evpasaeivlegyieqgetapegpygdhtgyynevdsfpvftvthitqredaiyhstytg
rp

SCOPe Domain Coordinates for d5m1ea1:

Click to download the PDB-style file with coordinates for d5m1ea1.
(The format of our PDB-style files is described here.)

Timeline for d5m1ea1:

  • d5m1ea1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12