SCOPe 2.08: Domain d5hflf1: 5hfl F:546-656

Lineage for d5hflf1 (5hfl F:546-656)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (4 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)

8. Domain d5hflf1: 5hfl F:546-656 [328086]
   Other proteins in same PDB: d5hfla2, d5hflb2, d5hflc2, d5hfld2, d5hfle2, d5hflf2
   automated match to d1f23b_

Details for d5hflf1

PDB Entry: 5hfl, 2.29 Å

PDB Description: gp41-targeting hiv-1 fusion inhibitors with helical ile-asp-leu tail

PDB Compounds: (F:) Envelope glycoprotein,gp41 CHR region

SCOPe Domain Sequences for d5hflf1:

Sequence, based on SEQRES records:

>d5hflf1 h.3.2.1 (F:546-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkkieeytkkieel
ikksqnqqidl

Sequence, based on observed residues (ATOM records):

>d5hflf1 h.3.2.1 (F:546-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgikqlqarilggweewdkkieeytkkieelikks
qnqqidl

Timeline for d5hflf1:

• d5hflf1 first appeared in SCOPe 2.06
  
• d5hflf1 appears in SCOPe 2.07