Lineage for d5m1ca1 (5m1c A:8-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055414Family b.45.1.3: UbiD middle domain-like [141368] (2 protein domains)
    N terminal part of Pfam PF01977; overall structural similarity to one subunit of the NADH:FMN oxidoreductase-like family (50482); not known to bind a flavin cofactor; also includes the N-terminal alpha+beta subdomain (~110 residues)
  6. 2284696Protein automated matches [327997] (2 species)
    not a true protein
  7. 2284703Species Escherichia coli [TaxId:199310] [328004] (3 PDB entries)
  8. 2284780Domain d5m1ca1: 5m1c A:8-325 [328081]
    Other proteins in same PDB: d5m1ca2, d5m1cb2, d5m1cc2
    automated match to d2idba1
    complexed with pg4

Details for d5m1ca1

PDB Entry: 5m1c (more details), 2.75 Å

PDB Description: crystal structure of n-terminally tagged apo-ubid from e. coli
PDB Compounds: (A:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOPe Domain Sequences for d5m1ca1:

Sequence, based on SEQRES records: (download)

>d5m1ca1 b.45.1.3 (A:8-325) automated matches {Escherichia coli [TaxId: 199310]}
dlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnlf
gtpkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnmptkrlrg
apcqqkivsgddvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyrqqligkn
klimrwlshrggaldyqewcaahpgerfpvsvalgadpatilgavtpvpdtlseyafagl
lrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgyynevdsfpvftvt
hitqredaiyhstytgrp

Sequence, based on observed residues (ATOM records): (download)

>d5m1ca1 b.45.1.3 (A:8-325) automated matches {Escherichia coli [TaxId: 199310]}
dlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnlf
gtpkrvamgmgqedvsalrevgkptkrlrgapcqqkivsgddvdlnripimtcwpedaap
litwgltvtrqnlgiyrqqligknklimrwlshrggaldyqewcaahpgerfpvsvalga
dpatilgavtagllrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgy
ynevdsfpvftvthitqredaiyhstytgrp

SCOPe Domain Coordinates for d5m1ca1:

Click to download the PDB-style file with coordinates for d5m1ca1.
(The format of our PDB-style files is described here.)

Timeline for d5m1ca1:

  • d5m1ca1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12