Lineage for d5hflc1 (5hfl C:546-656)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2267847Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 2267848Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 2267894Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 2267895Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)
  8. 2267930Domain d5hflc1: 5hfl C:546-656 [328066]
    Other proteins in same PDB: d5hfla2, d5hflb2, d5hflc2, d5hfld2, d5hfle2, d5hflf2
    automated match to d1f23b_

Details for d5hflc1

PDB Entry: 5hfl (more details), 2.29 Å

PDB Description: gp41-targeting hiv-1 fusion inhibitors with helical ile-asp-leu tail
PDB Compounds: (C:) Envelope glycoprotein,gp41 CHR region

SCOPe Domain Sequences for d5hflc1:

Sequence, based on SEQRES records: (download)

>d5hflc1 h.3.2.1 (C:546-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkkieeytkkieel
ikksqnqqidl

Sequence, based on observed residues (ATOM records): (download)

>d5hflc1 h.3.2.1 (C:546-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgikqlqarilsggweewdkkieeytkkieelikk
sqnqqidl

SCOPe Domain Coordinates for d5hflc1:

Click to download the PDB-style file with coordinates for d5hflc1.
(The format of our PDB-style files is described here.)

Timeline for d5hflc1: