Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.2: Virus ectodomain [58069] (2 families) |
Family h.3.2.1: Virus ectodomain [58070] (9 proteins) |
Protein Retrovius gp41 protease-resistant core [58071] (4 species) coiled coil; biological unit: trimer |
Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries) |
Domain d5hflc1: 5hfl C:546-656 [328066] Other proteins in same PDB: d5hfla2, d5hflb2, d5hflc2, d5hfld2, d5hfle2, d5hflf2 automated match to d1f23b_ |
PDB Entry: 5hfl (more details), 2.29 Å
SCOPe Domain Sequences for d5hflc1:
Sequence, based on SEQRES records: (download)
>d5hflc1 h.3.2.1 (C:546-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]} sgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkkieeytkkieel ikksqnqqidl
>d5hflc1 h.3.2.1 (C:546-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]} sgivqqqnnllraieaqqhllqltvwgikqlqarilsggweewdkkieeytkkieelikk sqnqqidl
Timeline for d5hflc1: