SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hflc1 (5hfl C:546-656)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2239684Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 2239685Family h.3.2.1: Virus ectodomain [58070] (9 protein domains)
  6. 2239731Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 2239732Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)
  8. 2284765Domain d5hflc1: 5hfl C:546-656 [328066]
    Other proteins in same PDB: d5hfla2, d5hflb2, d5hflc2, d5hfld2, d5hfle2, d5hflf2
    automated match to d1f23b_

Details for d5hflc1

PDB Entry: 5hfl (more details), 2.29 Å

PDB Description: gp41-targeting hiv-1 fusion inhibitors with helical ile-asp-leu tail
PDB Compounds: (C:) Envelope glycoprotein,gp41 CHR region

SCOPe Domain Sequences for d5hflc1:

Sequence, based on SEQRES records: (download)

>d5hflc1 h.3.2.1 (C:546-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkkieeytkkieel
ikksqnqqidl

Sequence, based on observed residues (ATOM records): (download)

>d5hflc1 h.3.2.1 (C:546-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgikqlqarilsggweewdkkieeytkkieelikk
sqnqqidl

SCOPe Domain Coordinates for d5hflc1:

Click to download the PDB-style file with coordinates for d5hflc1.
(The format of our PDB-style files is described here.)

Timeline for d5hflc1:

  • d5hflc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12