Lineage for d5m1ec2 (5m1e C:326-491)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216573Fold d.333: UbiD C-terminal domain-like [143967] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha-beta(2); 3 layers, a/b/a; mixed beta-sheet, order: 12354, strands 2,3 and 5 are parallel to each other
  4. 2216574Superfamily d.333.1: UbiD C-terminal domain-like [143968] (2 families) (S)
  5. 2284699Family d.333.1.0: automated matches [328000] (1 protein)
    not a true family
  6. 2284700Protein automated matches [328001] (2 species)
    not a true protein
  7. 2284705Species Escherichia coli [TaxId:199310] [328006] (3 PDB entries)
  8. 2284763Domain d5m1ec2: 5m1e C:326-491 [328064]
    Other proteins in same PDB: d5m1ea1, d5m1eb1, d5m1ec1
    automated match to d2idba2
    complexed with 7d9, mn, na

Details for d5m1ec2

PDB Entry: 5m1e (more details), 2.62 Å

PDB Description: crystal structure of n-terminally tagged ubid from e. coli reconstituted with prfmn cofactor
PDB Compounds: (C:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOPe Domain Sequences for d5m1ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m1ec2 d.333.1.0 (C:326-491) automated matches {Escherichia coli [TaxId: 199310]}
pdepavlgvalnevfvpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgv
wsflrqfmytkfvivcdddvnardwndviwaittrmdpardtvlventpidyldfaspvs
glgskmgldatnkwpgetqrewgrpikkdpdvvahidaiwdelaif

SCOPe Domain Coordinates for d5m1ec2:

Click to download the PDB-style file with coordinates for d5m1ec2.
(The format of our PDB-style files is described here.)

Timeline for d5m1ec2:

  • d5m1ec2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12