Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (21 species) not a true protein |
Species Lobophyllia hemprichii [TaxId:46758] [187486] (21 PDB entries) |
Domain d5fvgd_: 5fvg D: [328062] Other proteins in same PDB: d5fvgb2, d5fvgc2 automated match to d2vvjc_ complexed with so4 |
PDB Entry: 5fvg (more details), 1.9 Å
SCOPe Domain Sequences for d5fvgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fvgd_ d.22.1.0 (D:) automated matches {Lobophyllia hemprichii [TaxId: 46758]} msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
Timeline for d5fvgd_: