Lineage for d5fvgd_ (5fvg D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165512Species Lobophyllia hemprichii [TaxId:46758] [187486] (17 PDB entries)
  8. 2284761Domain d5fvgd_: 5fvg D: [328062]
    Other proteins in same PDB: d5fvgb2, d5fvgc2
    automated match to d2vvjc_
    complexed with so4

Details for d5fvgd_

PDB Entry: 5fvg (more details), 1.9 Å

PDB Description: structure of irisfp at 100 k.
PDB Compounds: (D:) Green to red photoconvertible GFP-like protein EosFP

SCOPe Domain Sequences for d5fvgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fvgd_ d.22.1.0 (D:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn

SCOPe Domain Coordinates for d5fvgd_:

Click to download the PDB-style file with coordinates for d5fvgd_.
(The format of our PDB-style files is described here.)

Timeline for d5fvgd_:

  • d5fvgd_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12