Class b: All beta proteins [48724] (177 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.3: UbiD middle domain-like [141368] (2 proteins) N terminal part of Pfam PF01977; overall structural similarity to one subunit of the NADH:FMN oxidoreductase-like family (50482); not known to bind a flavin cofactor; also includes the N-terminal alpha+beta subdomain (~110 residues) |
Protein automated matches [327997] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [327998] (1 PDB entry) |
Domain d5m1db1: 5m1d B:6-325 [328055] Other proteins in same PDB: d5m1da2, d5m1db2, d5m1dc2 automated match to d2idba1 complexed with 4lu, mn, na, so4 |
PDB Entry: 5m1d (more details), 2.7 Å
SCOPe Domain Sequences for d5m1db1:
Sequence, based on SEQRES records: (download)
>d5m1db1 b.45.1.3 (B:6-325) automated matches {Escherichia coli [TaxId: 562]} yndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcn lfgtpkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnmptkrl rgapcqqkivsgddvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyrqqlig knklimrwlshrggaldyqewcaahpgerfpvsvalgadpatilgavtpvpdtlseyafa gllrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgyynevdsfpvft vthitqredaiyhstytgrp
>d5m1db1 b.45.1.3 (B:6-325) automated matches {Escherichia coli [TaxId: 562]} yndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcn lfgtpkrvamgmgqedvsalrevgkllaflklnmptkrlrgapcqqkivsgddvdlnrip imtcwpedaaplitwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqew caahpgerfpvsvalgadpatilgavtpvpdtlseyafagllrgtktevvkcisndlevp asaeivlegyieqgetapegpygdhtgyynevdsfpvftvthitqredaiyhstytgrp
Timeline for d5m1db1:
View in 3D Domains from other chains: (mouse over for more information) d5m1da1, d5m1da2, d5m1dc1, d5m1dc2 |