Lineage for d5lqed2 (5lqe D:310-431)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000824Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2000825Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2000826Family a.74.1.1: Cyclin [47955] (9 protein domains)
  6. 2000839Protein Cyclin A [47956] (2 species)
  7. 2000875Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
    Uniprot P20248 175-432
  8. 2284752Domain d5lqed2: 5lqe D:310-431 [328053]
    Other proteins in same PDB: d5lqea1, d5lqea2, d5lqec1, d5lqec2
    automated match to d1oi9b2
    complexed with 72l

Details for d5lqed2

PDB Entry: 5lqe (more details), 2.97 Å

PDB Description: cdk2/cyclin a in complex with compound 73
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d5lqed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqed2 a.74.1.1 (D:310-431) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
ln

SCOPe Domain Coordinates for d5lqed2:

Click to download the PDB-style file with coordinates for d5lqed2.
(The format of our PDB-style files is described here.)

Timeline for d5lqed2:

  • d5lqed2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12