Lineage for d5hfmf1 (5hfm F:539-656)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2239684Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 2239685Family h.3.2.1: Virus ectodomain [58070] (9 protein domains)
  6. 2239731Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 2239732Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)
  8. 2284746Domain d5hfmf1: 5hfm F:539-656 [328047]
    Other proteins in same PDB: d5hfma2, d5hfmb2, d5hfmc2, d5hfmd2, d5hfme2, d5hfmf2
    automated match to d3cyoa_
    complexed with tam

Details for d5hfmf1

PDB Entry: 5hfm (more details), 2.3 Å

PDB Description: gp41-targeting hiv-1 fusion inhibitors with hook-like ile-asp-leu tail
PDB Compounds: (F:) Envelope glycoprotein gp160,gp41 CHR region

SCOPe Domain Sequences for d5hfmf1:

Sequence, based on SEQRES records: (download)

>d5hfmf1 h.3.2.1 (F:539-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
vqarqllsgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkkieey
tkkieelikksqnqqidl

Sequence, based on observed residues (ATOM records): (download)

>d5hfmf1 h.3.2.1 (F:539-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
vqarqllsgivqqqnnllraieaqqhllqltvwgikqlqarirggweewdkkieeytkki
eelikksqnqqidl

SCOPe Domain Coordinates for d5hfmf1:

Click to download the PDB-style file with coordinates for d5hfmf1.
(The format of our PDB-style files is described here.)

Timeline for d5hfmf1:

  • d5hfmf1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12