SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m1dc1 (5m1d C:7-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055414Family b.45.1.3: UbiD middle domain-like [141368] (2 protein domains)
    N terminal part of Pfam PF01977; overall structural similarity to one subunit of the NADH:FMN oxidoreductase-like family (50482); not known to bind a flavin cofactor; also includes the N-terminal alpha+beta subdomain (~110 residues)
  6. 2284696Protein automated matches [327997] (2 species)
    not a true protein
  7. 2284697Species Escherichia coli [TaxId:562] [327998] (1 PDB entry)
  8. 2284742Domain d5m1dc1: 5m1d C:7-325 [328043]
    Other proteins in same PDB: d5m1da2, d5m1db2, d5m1dc2
    automated match to d2idba1
    complexed with 4lu, mn, na, so4

Details for d5m1dc1

PDB Entry: 5m1d (more details), 2.7 Å

PDB Description: crystal structure of n-terminally tagged ubid from e. coli reconstituted with prfmn cofactor
PDB Compounds: (C:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOPe Domain Sequences for d5m1dc1:

Sequence, based on SEQRES records: (download)

>d5m1dc1 b.45.1.3 (C:7-325) automated matches {Escherichia coli [TaxId: 562]}
ndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnl
fgtpkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnmptkrlr
gapcqqkivsgddvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyrqqligk
nklimrwlshrggaldyqewcaahpgerfpvsvalgadpatilgavtpvpdtlseyafag
llrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgyynevdsfpvftv
thitqredaiyhstytgrp

Sequence, based on observed residues (ATOM records): (download)

>d5m1dc1 b.45.1.3 (C:7-325) automated matches {Escherichia coli [TaxId: 562]}
ndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnl
fgtpkrvamgmgqedvsalrevgkllaflkepmptkrlqqkivsgddvdlnripimtcwp
edaaplitwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewcaahpg
erfpvsvalgadpatilgavtpvpdtlseyafagllrgtktevvkcisndlevpasaeiv
legyieqgetapegpygdhtgyynevdsfpvftvthitqredaiyhstytgrp

SCOPe Domain Coordinates for d5m1dc1:

Click to download the PDB-style file with coordinates for d5m1dc1.
(The format of our PDB-style files is described here.)

Timeline for d5m1dc1:

  • d5m1dc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12