Lineage for d5hf4a1 (5hf4 A:302-402)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048519Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 2048522Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (12 PDB entries)
    Uniprot P31016 62-154
  8. 2284735Domain d5hf4a1: 5hf4 A:302-402 [328036]
    Other proteins in same PDB: d5hf4a2, d5hf4a3
    automated match to d1be9a_
    complexed with gol; mutant

Details for d5hf4a1

PDB Entry: 5hf4 (more details), 1.75 Å

PDB Description: the third pdz domain from the synaptic protein psd-95 (h372a mutant)
PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d5hf4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hf4a1 b.36.1.1 (A:302-402) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqils
vngvdlrnasaeqaaialknagqtvtiiaqykpeeysrfea

SCOPe Domain Coordinates for d5hf4a1:

Click to download the PDB-style file with coordinates for d5hf4a1.
(The format of our PDB-style files is described here.)

Timeline for d5hf4a1:

  • d5hf4a1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12