SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hf4a1 (5hf4 A:302-402)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048519Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 2048522Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (12 PDB entries)
    Uniprot P31016 62-154
  8. 2284735Domain d5hf4a1: 5hf4 A:302-402 [328036]
    Other proteins in same PDB: d5hf4a2, d5hf4a3
    automated match to d1be9a_
    complexed with gol; mutant

Details for d5hf4a1

PDB Entry: 5hf4 (more details), 1.75 Å

PDB Description: the third pdz domain from the synaptic protein psd-95 (h372a mutant)
PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d5hf4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hf4a1 b.36.1.1 (A:302-402) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqils
vngvdlrnasaeqaaialknagqtvtiiaqykpeeysrfea

SCOPe Domain Coordinates for d5hf4a1:

Click to download the PDB-style file with coordinates for d5hf4a1.
(The format of our PDB-style files is described here.)

Timeline for d5hf4a1:

  • d5hf4a1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12