Lineage for d5ku9b_ (5ku9 B:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2223824Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2223896Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2223897Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 protein domains)
    Pfam PF00452
  6. 2224027Protein automated matches [190236] (4 species)
    not a true protein
  7. 2284733Species Mus musculus, [TaxId:10090] [328034] (1 PDB entry)
  8. 2284734Domain d5ku9b_: 5ku9 B: [328035]
    automated match to d2kbwa_
    complexed with 6xj, na

Details for d5ku9b_

PDB Entry: 5ku9 (more details), 2.2 Å

PDB Description: crystal structure of mcl1
PDB Compounds: (B:) Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d5ku9b_:

Sequence, based on SEQRES records: (download)

>d5ku9b_ f.1.4.1 (B:) automated matches {Mus musculus, [TaxId: 10090]}
dlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgml
rkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplae
sitdvlvrtkrdwlvkqrgwdgfveffhve

Sequence, based on observed residues (ATOM records): (download)

>d5ku9b_ f.1.4.1 (B:) automated matches {Mus musculus, [TaxId: 10090]}
dlyrqsleiisrylreqatgrraletlrrvgdgvqrnhetafqgmlrkldikneddvksl
srvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesitdvlvrtkrdwl
vkqrgwdgfveffhve

SCOPe Domain Coordinates for d5ku9b_:

Click to download the PDB-style file with coordinates for d5ku9b_.
(The format of our PDB-style files is described here.)

Timeline for d5ku9b_:

  • d5ku9b_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12