SCOPe 2.08: Domain d5ku9b_: 5ku9 B:

Lineage for d5ku9b_ (5ku9 B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118213] (6 PDB entries)
   Uniprot P97287 152-308

8. Domain d5ku9b_: 5ku9 B: [328035]
   automated match to d2kbwa_
   complexed with 6xj, na

Details for d5ku9b_

PDB Entry: 5ku9, 2.2 Å

PDB Description: crystal structure of mcl1 with compound 1

PDB Compounds: (B:) Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d5ku9b_:

Sequence, based on SEQRES records:

>d5ku9b_ f.1.4.1 (B:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
dlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgml
rkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplae
sitdvlvrtkrdwlvkqrgwdgfveffhve

Sequence, based on observed residues (ATOM records):

>d5ku9b_ f.1.4.1 (B:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
dlyrqsleiisrylreqatgrraletlrrvgdgvqrnhetafqgmlrkldikneddvksl
srvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesitdvlvrtkrdwl
vkqrgwdgfveffhve

Timeline for d5ku9b_:

• d5ku9b_ first appeared in SCOPe 2.06
  
• d5ku9b_ appears in SCOPe 2.07