SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ghma_ (5ghm A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189565Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2189566Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2189567Family d.113.1.1: MutT-like [55812] (17 protein domains)
  6. 2189568Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (1 species)
  7. 2189569Species Human (Homo sapiens) [TaxId:9606] [103208] (20 PDB entries)
  8. 2284723Domain d5ghma_: 5ghm A: [328024]
    automated match to d1irya_
    protein/DNA complex; complexed with 8dg, na; mutant

Details for d5ghma_

PDB Entry: 5ghm (more details), 1.5 Å

PDB Description: crystal structure of human mth1(g2k/d120n mutant) in complex with 8- oxo-dgtp
PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d5ghma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ghma_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdn
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d5ghma_:

Click to download the PDB-style file with coordinates for d5ghma_.
(The format of our PDB-style files is described here.)

Timeline for d5ghma_:

  • d5ghma_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12