Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Staphylococcus aureus [TaxId:367830] [327973] (2 PDB entries) |
Domain d5kzee_: 5kze E: [328021] automated match to d4ahob_ complexed with gol, so4 |
PDB Entry: 5kze (more details), 1.74 Å
SCOPe Domain Sequences for d5kzee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kzee_ c.1.10.0 (E:) automated matches {Staphylococcus aureus [TaxId: 367830]} nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
Timeline for d5kzee_: