Lineage for d5kzdb_ (5kzd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2284672Species Staphylococcus aureus [TaxId:367830] [327973] (2 PDB entries)
  8. 2284717Domain d5kzdb_: 5kzd B: [328018]
    automated match to d4ahob_
    complexed with rcj

Details for d5kzdb_

PDB Entry: 5kzd (more details), 2.33 Å

PDB Description: n-acetylneuraminate lyase from methicillin-resistant staphylococcus aureus with bound sialic acid alditol
PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5kzdb_:

Sequence, based on SEQRES records: (download)

>d5kzdb_ c.1.10.0 (B:) automated matches {Staphylococcus aureus [TaxId: 367830]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

Sequence, based on observed residues (ATOM records): (download)

>d5kzdb_ c.1.10.0 (B:) automated matches {Staphylococcus aureus [TaxId: 367830]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyaisieqfselfnhekivgvkytapnffllerirkafpdklilsg
fdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndiietvlsm
giyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d5kzdb_:

Click to download the PDB-style file with coordinates for d5kzdb_.
(The format of our PDB-style files is described here.)

Timeline for d5kzdb_:

  • d5kzdb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12