SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kzdb_ (5kzd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (73 species)
    not a true protein
  7. 2284672Species Staphylococcus aureus [TaxId:367830] [327973] (2 PDB entries)
  8. 2284717Domain d5kzdb_: 5kzd B: [328018]
    automated match to d4ahob_
    complexed with rcj

Details for d5kzdb_

PDB Entry: 5kzd (more details), 2.33 Å

PDB Description: n-acetylneuraminate lyase from methicillin-resistant staphylococcus aureus with bound sialic acid alditol
PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5kzdb_:

Sequence, based on SEQRES records: (download)

>d5kzdb_ c.1.10.0 (B:) automated matches {Staphylococcus aureus [TaxId: 367830]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

Sequence, based on observed residues (ATOM records): (download)

>d5kzdb_ c.1.10.0 (B:) automated matches {Staphylococcus aureus [TaxId: 367830]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyaisieqfselfnhekivgvkytapnffllerirkafpdklilsg
fdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndiietvlsm
giyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d5kzdb_:

Click to download the PDB-style file with coordinates for d5kzdb_.
(The format of our PDB-style files is described here.)

Timeline for d5kzdb_:

  • d5kzdb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12