Lineage for d5m2vb_ (5m2v B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145930Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (101 PDB entries)
  8. 2284715Domain d5m2vb_: 5m2v B: [328016]
    automated match to d4mf3a_
    complexed with 7e5, cl, so4

Details for d5m2vb_

PDB Entry: 5m2v (more details), 3.18 Å

PDB Description: structure of gluk1 ligand-binding domain (s1s2) in complex with (2s, 4r)-4-(2-carboxyphenoxy)pyrrolidine-2-carboxylic acid at 3.18 a resolution
PDB Compounds: (B:) Glutamate receptor ionotropic, kainate 1,Glutamate receptor ionotropic, kainate 1

SCOPe Domain Sequences for d5m2vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m2vb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkygaq
ndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpidsad
dlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvlttd
yallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegklh
mmkekwwrgngcp

SCOPe Domain Coordinates for d5m2vb_:

Click to download the PDB-style file with coordinates for d5m2vb_.
(The format of our PDB-style files is described here.)

Timeline for d5m2vb_:

  • d5m2vb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12