SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ezlb2 (5ezl B:132-237)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (529 PDB entries)
  8. 2284714Domain d5ezlb2: 5ezl B:132-237 [328015]
    automated match to d2f5al2
    complexed with nag

Details for d5ezlb2

PDB Entry: 5ezl (more details), 2.43 Å

PDB Description: crystal structure of fab c12
PDB Compounds: (B:) Fab c12

SCOPe Domain Sequences for d5ezlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ezlb2 b.1.1.0 (B:132-237) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5ezlb2:

Click to download the PDB-style file with coordinates for d5ezlb2.
(The format of our PDB-style files is described here.)

Timeline for d5ezlb2:

  • d5ezlb2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5ezlb1