Lineage for d5m08a_ (5m08 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2284711Species Mycobacterium tuberculosis [TaxId:83332] [328012] (4 PDB entries)
  8. 2284712Domain d5m08a_: 5m08 A: [328013]
    automated match to d1o6ya_
    mutant

Details for d5m08a_

PDB Entry: 5m08 (more details), 3.03 Å

PDB Description: crystal structure of mycobacterium tuberculosis pkni kinase domain, c20a_r136a double mutant
PDB Compounds: (A:) Serine/threonine-protein kinase PknI

SCOPe Domain Sequences for d5m08a_:

Sequence, based on SEQRES records: (download)

>d5m08a_ d.144.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
malasgvtfagytvvrmlgasamgevylvqhpgfpgwqalkvlspamaaddefrrrfqre
tevaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivta
vagaldyahqrgllhadvnpanvvltsqsagdqrilladfgiasqpsypapelsagadvd
gradqyalaltaihlfagappvdrshtgplqppklsafrpdlarldgvlsralatapadr
fgscrefadamneqag

Sequence, based on observed residues (ATOM records): (download)

>d5m08a_ d.144.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
malasgvtfagytvvrmlgasamgevylvqhpgfpgwqalkvlspamaaddefrrrfqre
tevaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivta
vagaldyahqrgllhadvnpanvvltsqdqrilladfgiasqpsypapelsagadvdgra
dqyalaltaihlfagappvdrqppklsafrpdlarldgvlsralatapadrfgscrefad
amneqag

SCOPe Domain Coordinates for d5m08a_:

Click to download the PDB-style file with coordinates for d5m08a_.
(The format of our PDB-style files is described here.)

Timeline for d5m08a_:

  • d5m08a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from other chains:
(mouse over for more information)
d5m08b_