Lineage for d5h35g2 (5h35 G:113-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753182Domain d5h35g2: 5h35 G:113-217 [328010]
    Other proteins in same PDB: d5h35a_, d5h35b1, d5h35f_, d5h35g1, d5h35h_, d5h35i1
    automated match to d1t66c2
    complexed with gol, na, px4

Details for d5h35g2

PDB Entry: 5h35 (more details), 2.64 Å

PDB Description: crystal structures of the tric trimeric intracellular cation channel orthologue from sulfolobus solfataricus
PDB Compounds: (G:) Fab light chain

SCOPe Domain Sequences for d5h35g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h35g2 b.1.1.2 (G:113-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5h35g2:

Click to download the PDB-style file with coordinates for d5h35g2.
(The format of our PDB-style files is described here.)

Timeline for d5h35g2: