Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
Domain d5h35g1: 5h35 G:1-112 [328009] Other proteins in same PDB: d5h35b2, d5h35g2, d5h35i2 automated match to d1t66c1 complexed with gol, na, px4 |
PDB Entry: 5h35 (more details), 2.64 Å
SCOPe Domain Sequences for d5h35g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h35g1 b.1.1.1 (G:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmtqtplslpvslgdqasiscrssqfivhsngntylewylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleik
Timeline for d5h35g1:
View in 3D Domains from other chains: (mouse over for more information) d5h35b1, d5h35b2, d5h35i1, d5h35i2 |